SCOPe 2.07: Domain d6xarb2: 6xar B:178-263

Lineage for d6xarb2 (6xar B:178-263)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.7: EF-hand modules in multidomain proteins [47547] (9 proteins)

6. Protein Cbl [47561] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47562] (12 PDB entries)

8. Domain d6xarb2: 6xar B:178-263 [401043]
   Other proteins in same PDB: d6xara1, d6xara3, d6xarb1, d6xarb3
   automated match to d3buxb1
   complexed with ca

Details for d6xarb2

PDB Entry: 6xar, 2.5 Å

PDB Description: structure of cbl tyrosine kinase binding domain (tkbd) with c-terminal tail of src-like kinase protein 2 (slap2)

PDB Compounds: (B:) E3 ubiquitin-protein ligase CBL

SCOPe Domain Sequences for d6xarb2:

Sequence; same for both SEQRES and ATOM records:

>d6xarb2 a.39.1.7 (B:178-263) Cbl {Human (Homo sapiens) [TaxId: 9606]}
tfritkadaaefwrkafgektivpwksfrqalhevhpissgleamalkstidltcndyis
vfefdiftrlfqpwssllrnwnslav

Timeline for d6xarb2:

• d6xarb2 is new in SCOPe 2.07-stable
  
• d6xarb2 appears in the current release, SCOPe 2.08