Lineage for d6vx4g_ (6vx4 G:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2606368Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. 2606369Superfamily d.166.1: ADP-ribosylation [56399] (8 families) (S)
  5. 2606665Family d.166.1.0: automated matches [191650] (1 protein)
    not a true family
  6. 2606666Protein automated matches [191197] (12 species)
    not a true protein
  7. 2606850Species Salmonella enterica [TaxId:220341] [400991] (1 PDB entry)
  8. 2606851Domain d6vx4g_: 6vx4 G: [400992]
    Other proteins in same PDB: d6vx4f_, d6vx4k_
    automated match to d4k6lg_

Details for d6vx4g_

PDB Entry: 6vx4 (more details), 3.12 Å

PDB Description: density-fitted model structure of antibody variable domains of tytx11 in complex with typhoid toxin
PDB Compounds: (G:) Pertussis toxin-like subunit ArtA

SCOPe Domain Sequences for d6vx4g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6vx4g_ d.166.1.0 (G:) automated matches {Salmonella enterica [TaxId: 220341]}
vdfvyrvdstppdvifrdgfsllgynrnfqqfisgrscsggssdsryiattssvnqtyai
arayysrstfkgnlyryqiradnnfysllpsityletqgghfnayektmmrlqreyvstl
silpeniqkavalvydsatglvkdgvstmnasylglsttsnpgvipflpepqtytqqrid
afgplisscfsigsvchshrgqradvynmsfydarpvielilsk

SCOPe Domain Coordinates for d6vx4g_:

Click to download the PDB-style file with coordinates for d6vx4g_.
(The format of our PDB-style files is described here.)

Timeline for d6vx4g_: