Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.166: ADP-ribosylation [56398] (1 superfamily) unusual fold |
Superfamily d.166.1: ADP-ribosylation [56399] (8 families) |
Family d.166.1.0: automated matches [191650] (1 protein) not a true family |
Protein automated matches [191197] (12 species) not a true protein |
Species Salmonella enterica [TaxId:220341] [400991] (1 PDB entry) |
Domain d6vx4g_: 6vx4 G: [400992] Other proteins in same PDB: d6vx4f_, d6vx4k_ automated match to d4k6lg_ |
PDB Entry: 6vx4 (more details), 3.12 Å
SCOPe Domain Sequences for d6vx4g_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6vx4g_ d.166.1.0 (G:) automated matches {Salmonella enterica [TaxId: 220341]} vdfvyrvdstppdvifrdgfsllgynrnfqqfisgrscsggssdsryiattssvnqtyai arayysrstfkgnlyryqiradnnfysllpsityletqgghfnayektmmrlqreyvstl silpeniqkavalvydsatglvkdgvstmnasylglsttsnpgvipflpepqtytqqrid afgplisscfsigsvchshrgqradvynmsfydarpvielilsk
Timeline for d6vx4g_: