Lineage for d1gavd_ (1gav D:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 331428Fold d.85: RNA bacteriophage capsid protein [55404] (1 superfamily)
    6-standed beta-sheet followed with 2 helices; meander
  4. 331429Superfamily d.85.1: RNA bacteriophage capsid protein [55405] (1 family) (S)
  5. 331430Family d.85.1.1: RNA bacteriophage capsid protein [55406] (5 proteins)
  6. 331439Protein GA coat protein [55409] (1 species)
  7. 331440Species Bacteriophage GA [TaxId:12018] [55410] (2 PDB entries)
  8. 331456Domain d1gavd_: 1gav D: [40099]

Details for d1gavd_

PDB Entry: 1gav (more details), 3.4 Å

PDB Description: bacteriophage ga protein capsid

SCOP Domain Sequences for d1gavd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gavd_ d.85.1.1 (D:) GA coat protein {Bacteriophage GA}
atlrsfvlvdnggtgnvtvvpvsnangvaewlsnnsrsqayrvtasyrasgadkrkytik
levpkivtqvvngvelpvsawkayasidltipifaatddvtviskslaglfkvgnpiaea
issqsgfya

SCOP Domain Coordinates for d1gavd_:

Click to download the PDB-style file with coordinates for d1gavd_.
(The format of our PDB-style files is described here.)

Timeline for d1gavd_: