SCOPe 2.08: Domain d6x0cb_: 6x0c B:

Lineage for d6x0cb_ (6x0c B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214

4. Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families)

5. Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 proteins)

6. Protein Tryptophan synthase, beta-subunit [53688] (4 species)

7. Species Salmonella typhimurium [TaxId:90371] [53689] (66 PDB entries)

8. Domain d6x0cb_: 6x0c B: [400973]
   Other proteins in same PDB: d6x0ca_
   automated match to d4zqcb_
   complexed with 0jo, bzi, cl, cs, dms, edo, peg; mutant

Details for d6x0cb_

PDB Entry: 6x0c, 1.45 Å

PDB Description: tryptophan synthase mutant beta-q114a in complex with cesium ion at the metal coordination site and aminoacrylate and benzimidazole at the enzyme beta site

PDB Compounds: (B:) tryptophan synthase beta chain

SCOPe Domain Sequences for d6x0cb_:

Sequence; same for both SEQRES and ATOM records:

>d6x0cb_ c.79.1.1 (B:) Tryptophan synthase, beta-subunit {Salmonella typhimurium [TaxId: 90371]}
ttllnpyfgefggmyvpqilmpalnqleeafvsaqkdpefqaqfadllknyagrptaltk
cqnitagtrttlylkredllhggahktnqvlgqallakrmgkseiiaetgagahgvasal
asallglkcriymgakdverqspnvfrmrlmgaevipvhsgsatlkdacnealrdwsgsy
etahymlgtaagphpyptivrefqrmigeetkaqildkegrlpdaviacvgggsnaigmf
adfindtsvgligvepgghgietgehgaplkhgrvgiyfgmkapmmqtadgqieesysis
agldfpsvgpqhaylnsigradyvsitddealeafktlcrhegiipalesshalahalkm
mreqpekeqllvvnlsgrgdkdiftvhdilkarg

Timeline for d6x0cb_:

• d6x0cb_ first appeared in SCOPe 2.07