SCOP 1.65: Domain d1unab_: 1una B:

Lineage for d1unab_ (1una B:)

1. Root: SCOP 1.65

2. Class d: Alpha and beta proteins (a+b) [53931] (234 folds)

3. Fold d.85: RNA bacteriophage capsid protein [55404] (1 superfamily)
   6-standed beta-sheet followed with 2 helices; meander

4. Superfamily d.85.1: RNA bacteriophage capsid protein [55405] (1 family)

5. Family d.85.1.1: RNA bacteriophage capsid protein [55406] (5 proteins)

6. Protein GA coat protein [55409] (1 species)

7. Species Bacteriophage GA [TaxId:12018] [55410] (2 PDB entries)

8. Domain d1unab_: 1una B: [40095]

Details for d1unab_

PDB Entry: 1una, 2.8 Å

PDB Description: unassembled virus coat protein dimer, bacteriophage rna-binding dimer

SCOP Domain Sequences for d1unab_:

Sequence, based on SEQRES records:

>d1unab_ d.85.1.1 (B:) GA coat protein {Bacteriophage GA}
atlhsfvlvdnggtgnvtvvpvsnangvaewlsnnsrsqayrvtasyrasgadkrkytik
levpkivtqvvngvelpvsawkayasidltipifaatddvtvisksltglfkvgnpiaea
issqsgfya

Sequence, based on observed residues (ATOM records):

>d1unab_ d.85.1.1 (B:) GA coat protein {Bacteriophage GA}
atlhsfvlvdnggtgnvtvvpvsnangvaewlsnnsrsqayrvtasyrasgadkrkytik
levpkivelpvsawkayasidltipifaatddvtvisksltglfkvgnpiaeaissqsgf
ya

Timeline for d1unab_:

• d1unab_ first appeared (with stable ids) in SCOP 1.55
  
• d1unab_ appears in SCOP 1.63
  
• d1unab_ appears in SCOP 1.67
  
• d1unab_ appears in the current release, SCOPe 2.08