Lineage for d6woha_ (6woh A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2577867Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 2577868Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. 2577869Family d.113.1.1: MutT-like [55812] (17 proteins)
  6. 2578152Protein automated matches [190465] (6 species)
    not a true protein
  7. 2578169Species Human (Homo sapiens) [TaxId:9606] [189707] (27 PDB entries)
  8. 2578187Domain d6woha_: 6woh A: [400942]
    automated match to d5ltub_
    complexed with 4wz, so4

Details for d6woha_

PDB Entry: 6woh (more details), 1.7 Å

PDB Description: diphosphoinositol polyphosphate phosphohydrolase 1 (dipp1/nudt3) in complex with 1,5-di-methylenebisphosphonate inositol tetrakisphosphate (1,5-pcp-ip4)
PDB Compounds: (A:) Diphosphoinositol polyphosphate phosphohydrolase 1

SCOPe Domain Sequences for d6woha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6woha_ d.113.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
trtydgdgykkraaclcfrseseeevllvsssrhpdrwivpgggmepeeepsvaavrevc
eeagvkgtlgrlvgifenqerkhrtyvyvlivtevledwedsvnigrkrewfkiedaikv
lqyhkpvqasyfet

SCOPe Domain Coordinates for d6woha_:

Click to download the PDB-style file with coordinates for d6woha_.
(The format of our PDB-style files is described here.)

Timeline for d6woha_: