Lineage for d1unaa_ (1una A:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 728525Fold d.85: RNA bacteriophage capsid protein [55404] (1 superfamily)
    6-standed beta-sheet followed with 2 helices; meander
  4. 728526Superfamily d.85.1: RNA bacteriophage capsid protein [55405] (1 family) (S)
  5. 728527Family d.85.1.1: RNA bacteriophage capsid protein [55406] (5 proteins)
  6. 728536Protein GA coat protein [55409] (1 species)
  7. 728537Species Bacteriophage GA [TaxId:12018] [55410] (2 PDB entries)
  8. 728538Domain d1unaa_: 1una A: [40094]

Details for d1unaa_

PDB Entry: 1una (more details), 2.8 Å

PDB Description: unassembled virus coat protein dimer, bacteriophage rna-binding dimer
PDB Compounds: (A:) ga unassembled coat protein dimer

SCOP Domain Sequences for d1unaa_:

Sequence, based on SEQRES records: (download)

>d1unaa_ d.85.1.1 (A:) GA coat protein {Bacteriophage GA [TaxId: 12018]}
atlhsfvlvdnggtgnvtvvpvsnangvaewlsnnsrsqayrvtasyrasgadkrkytik
levpkivtqvvngvelpvsawkayasidltipifaatddvtvisksltglfkvgnpiaea
issqsgfya

Sequence, based on observed residues (ATOM records): (download)

>d1unaa_ d.85.1.1 (A:) GA coat protein {Bacteriophage GA [TaxId: 12018]}
atlhsfvlvdnggtgnvtvvpvsnangvaewlsnnsrsqayrvtasyrasgadkrkytik
levpkivelpvsawkayasidltipifaatddvtvisksltglfkvgnpiaeaissqsgf
ya

SCOP Domain Coordinates for d1unaa_:

Click to download the PDB-style file with coordinates for d1unaa_.
(The format of our PDB-style files is described here.)

Timeline for d1unaa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1unab_