SCOPe 2.07: Domain d6wtib2: 6wti B:118-285

Lineage for d6wtib2 (6wti B:118-285)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (3 proteins)

6. Protein Quinol oxidase (CyoA) [49542] (1 species)

7. Species Escherichia coli [TaxId:562] [49543] (4 PDB entries)

8. Domain d6wtib2: 6wti B:118-285 [400921]
   Other proteins in same PDB: d6wtib1
   automated match to d1fftb1
   complexed with 3pe, cu, hem, heo, u9v, uq8

Details for d6wtib2

PDB Entry: 6wti, 2.38 Å

PDB Description: the cryo-em structure of the ubiquinol oxidase from escherichia coli

PDB Compounds: (B:) Ubiquinol oxidase subunit 2

SCOPe Domain Sequences for d6wtib2:

Sequence; same for both SEQRES and ATOM records:

>d6wtib2 b.6.1.2 (B:118-285) Quinol oxidase (CyoA) {Escherichia coli [TaxId: 562]}
kplahdekpitievvsmdwkwffiypeqgiatvneiafpantpvyfkvtsnsvmnsffip
rlgsqiyamagmqtrlhlianepgtydgisasysgpgfsgmkfkaiatpdraafdqwvak
akqspntmsdmaafeklaapseynqveyfsnvkpdlfadvinkfmahg

Timeline for d6wtib2:

• d6wtib2 is new in SCOPe 2.07-stable
  
• d6wtib2 appears in the current release, SCOPe 2.08