Lineage for d6wtib1 (6wti B:24-117)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2629297Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies)
    two antiparallel transmembrane helices
  4. 2629435Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (2 families) (S)
  5. 2629436Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (5 proteins)
  6. 2629483Protein Cytochrome O ubiquinol oxidase, subunit II [81462] (1 species)
  7. 2629484Species Escherichia coli [TaxId:562] [81461] (2 PDB entries)
  8. 2629485Domain d6wtib1: 6wti B:24-117 [400920]
    Other proteins in same PDB: d6wtib2
    automated match to d1fftb2
    complexed with 3pe, cu, hem, heo, u9v, uq8

Details for d6wtib1

PDB Entry: 6wti (more details), 2.38 Å

PDB Description: the cryo-em structure of the ubiquinol oxidase from escherichia coli
PDB Compounds: (B:) Ubiquinol oxidase subunit 2

SCOPe Domain Sequences for d6wtib1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6wtib1 f.17.2.1 (B:24-117) Cytochrome O ubiquinol oxidase, subunit II {Escherichia coli [TaxId: 562]}
gcnsalldpkgqigleqrsliltafglmlivvipailmavgfawkyrasnkdakyspnws
hsnkveavvwtvpiliiiflavltwktthaleps

SCOPe Domain Coordinates for d6wtib1:

Click to download the PDB-style file with coordinates for d6wtib1.
(The format of our PDB-style files is described here.)

Timeline for d6wtib1: