SCOPe 2.07: Domain d6wtib1: 6wti B:24-117

Lineage for d6wtib1 (6wti B:24-117)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies)
   two antiparallel transmembrane helices

4. Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (2 families)

5. Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (5 proteins)

6. Protein Cytochrome O ubiquinol oxidase, subunit II [81462] (1 species)

7. Species Escherichia coli [TaxId:562] [81461] (2 PDB entries)

8. Domain d6wtib1: 6wti B:24-117 [400920]
   Other proteins in same PDB: d6wtib2
   automated match to d1fftb2
   complexed with 3pe, cu, hem, heo, u9v, uq8

Details for d6wtib1

PDB Entry: 6wti, 2.38 Å

PDB Description: the cryo-em structure of the ubiquinol oxidase from escherichia coli

PDB Compounds: (B:) Ubiquinol oxidase subunit 2

SCOPe Domain Sequences for d6wtib1:

Sequence; same for both SEQRES and ATOM records:

>d6wtib1 f.17.2.1 (B:24-117) Cytochrome O ubiquinol oxidase, subunit II {Escherichia coli [TaxId: 562]}
gcnsalldpkgqigleqrsliltafglmlivvipailmavgfawkyrasnkdakyspnws
hsnkveavvwtvpiliiiflavltwktthaleps

Timeline for d6wtib1:

• d6wtib1 is new in SCOPe 2.07-stable
  
• d6wtib1 appears in the current release, SCOPe 2.08