SCOPe 2.08: Domain d6wh5c1: 6wh5 C:4-188

Lineage for d6wh5c1 (6wh5 C:4-188)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.2: Cobalamin adenosyltransferase-like [89028] (3 families)
   crossover loop goes across a different side of the 4-helical bundle; no internal metal-binding site

5. Family a.25.2.0: automated matches [191442] (1 protein)
   not a true family

6. Protein automated matches [190652] (6 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:1773] [187731] (5 PDB entries)

8. Domain d6wh5c1: 6wh5 C:4-188 [400908]
   Other proteins in same PDB: d6wh5a2, d6wh5b2, d6wh5c2
   automated match to d3gaha_
   complexed with 3po, b12, k, mg

Details for d6wh5c1

PDB Entry: 6wh5, 1.87 Å

PDB Description: mycobacterium tuberculosis pduo-type atp:cobalamin adenosyltransferase bound to cob(ii)alamin and pppi

PDB Compounds: (C:) Corrinoid adenosyltransferase

SCOPe Domain Sequences for d6wh5c1:

Sequence; same for both SEQRES and ATOM records:

>d6wh5c1 a.25.2.0 (C:4-188) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
hltriytrtgddgttglsdmsrvaktdarlvayadcdeanaaigaalalghpdtqitdvl
rqiqndlfdagadlstpivenpkhpplriaqsyidrlegwcdaynaglpalksfvlpggs
plsallhvartvvrraersawaavdahpegvsvlpakylnrlsdllfilsrvanpdgdvl
wrpgg

Timeline for d6wh5c1:

• d6wh5c1 first appeared in SCOPe 2.07, called d6wh5c_