SCOP 1.69: Domain d1mvac_: 1mva C:

Lineage for d1mvac_ (1mva C:)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.85: RNA bacteriophage capsid protein [55404] (1 superfamily)
   6-standed beta-sheet followed with 2 helices; meander

4. Superfamily d.85.1: RNA bacteriophage capsid protein [55405] (1 family)

5. Family d.85.1.1: RNA bacteriophage capsid protein [55406] (5 proteins)

6. Protein MS2 virus coat protein [55407] (1 species)

7. Species Bacteriophage MS2 [TaxId:12022] [55408] (25 PDB entries)

8. Domain d1mvac_: 1mva C: [40090]

Details for d1mvac_

PDB Entry: 1mva, 3 Å

PDB Description: structure of a protein capsid of the t45a mutant of phage ms2

SCOP Domain Sequences for d1mvac_:

Sequence; same for both SEQRES and ATOM records:

>d1mvac_ d.85.1.1 (C:) MS2 virus coat protein {Bacteriophage MS2}
asnftqfvlvdnggtgdvtvapsnfangvaewissnsrsqaykvacsvrqssaqnrkyti
kvevpkvatqtvggvelpvaawrsylnmeltipifatnsdcelivkamqgllkdgnpips
aiaansgiy

Timeline for d1mvac_:

• d1mvac_ first appeared (with stable ids) in SCOP 1.55
  
• d1mvac_ appears in SCOP 1.67
  
• d1mvac_ appears in SCOP 1.71
  
• d1mvac_ appears in the current release, SCOPe 2.08