Lineage for d6wh5b_ (6wh5 B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2314150Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2318511Superfamily a.25.2: Cobalamin adenosyltransferase-like [89028] (3 families) (S)
    crossover loop goes across a different side of the 4-helical bundle; no internal metal-binding site
  5. 2318530Family a.25.2.0: automated matches [191442] (1 protein)
    not a true family
  6. 2318531Protein automated matches [190652] (6 species)
    not a true protein
  7. 2318568Species Mycobacterium tuberculosis [TaxId:1773] [187731] (5 PDB entries)
  8. 2318573Domain d6wh5b_: 6wh5 B: [400899]
    automated match to d3gaha_
    complexed with 3po, b12, k, mg

Details for d6wh5b_

PDB Entry: 6wh5 (more details), 1.87 Å

PDB Description: mycobacterium tuberculosis pduo-type atp:cobalamin adenosyltransferase bound to cob(ii)alamin and pppi
PDB Compounds: (B:) Corrinoid adenosyltransferase

SCOPe Domain Sequences for d6wh5b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6wh5b_ a.25.2.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
vhltriytrtgddgttglsdmsrvaktdarlvayadcdeanaaigaalalghpdtqitdv
lrqiqndlfdagadlstpivenpkhpplriaqsyidrlegwcdaynaglpalksfvlpgg
splsallhvartvvrraersawaavdahpegvsvlpakylnrlsdllfilsrvanpdgdv
lwrpgg

SCOPe Domain Coordinates for d6wh5b_:

Click to download the PDB-style file with coordinates for d6wh5b_.
(The format of our PDB-style files is described here.)

Timeline for d6wh5b_:

  • d6wh5b_ is new in SCOPe 2.07-stable
  • d6wh5b_ appears in the current release, SCOPe 2.08, called d6wh5b1