Lineage for d6wgsa_ (6wgs A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2314150Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2318511Superfamily a.25.2: Cobalamin adenosyltransferase-like [89028] (3 families) (S)
    crossover loop goes across a different side of the 4-helical bundle; no internal metal-binding site
  5. 2318530Family a.25.2.0: automated matches [191442] (1 protein)
    not a true family
  6. 2318531Protein automated matches [190652] (6 species)
    not a true protein
  7. 2318568Species Mycobacterium tuberculosis [TaxId:1773] [187731] (5 PDB entries)
  8. 2318569Domain d6wgsa_: 6wgs A: [400896]
    automated match to d3gaha_
    complexed with 5ad, b12

Details for d6wgsa_

PDB Entry: 6wgs (more details), 1.5 Å

PDB Description: mycobacterium tuberculosis pduo-type atp:cobalamin adenosyltransferase bound to adenosylcobalamin
PDB Compounds: (A:) Corrinoid adenosyltransferase

SCOPe Domain Sequences for d6wgsa_:

Sequence, based on SEQRES records: (download)

>d6wgsa_ a.25.2.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
rtgddgttglsdmsrvaktdarlvayadcdeanaaigaalalghpdtqitdvlrqiqndl
fdagadlstpivenpkhpplriaqsyidrlegwcdaynaglpalksfvlpggsplsallh
vartvvrraersawaavdahpegvsvlpakylnrlsdllfilsrvanpdgdvlwrpgg

Sequence, based on observed residues (ATOM records): (download)

>d6wgsa_ a.25.2.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
rgddgttglsdmsrvaktdarlvayadcdeanaaigaalalghpdtqitdvlrqiqndlf
dagadlstpivenpkhpplriaqsyidrlegwcdaynaglpalksfvlpggsplsallhv
artvvrraersawaavdahpegvsvlpakylnrlsdllfilsrvanpdgdvlwrpgg

SCOPe Domain Coordinates for d6wgsa_:

Click to download the PDB-style file with coordinates for d6wgsa_.
(The format of our PDB-style files is described here.)

Timeline for d6wgsa_: