Lineage for d1mvaa_ (1mva A:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 331428Fold d.85: RNA bacteriophage capsid protein [55404] (1 superfamily)
    6-standed beta-sheet followed with 2 helices; meander
  4. 331429Superfamily d.85.1: RNA bacteriophage capsid protein [55405] (1 family) (S)
  5. 331430Family d.85.1.1: RNA bacteriophage capsid protein [55406] (5 proteins)
  6. 331479Protein MS2 virus coat protein [55407] (1 species)
  7. 331480Species Bacteriophage MS2 [TaxId:12022] [55408] (25 PDB entries)
  8. 331536Domain d1mvaa_: 1mva A: [40088]

Details for d1mvaa_

PDB Entry: 1mva (more details), 3 Å

PDB Description: structure of a protein capsid of the t45a mutant of phage ms2

SCOP Domain Sequences for d1mvaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mvaa_ d.85.1.1 (A:) MS2 virus coat protein {Bacteriophage MS2}
asnftqfvlvdnggtgdvtvapsnfangvaewissnsrsqaykvacsvrqssaqnrkyti
kvevpkvatqtvggvelpvaawrsylnmeltipifatnsdcelivkamqgllkdgnpips
aiaansgiy

SCOP Domain Coordinates for d1mvaa_:

Click to download the PDB-style file with coordinates for d1mvaa_.
(The format of our PDB-style files is described here.)

Timeline for d1mvaa_: