Class a: All alpha proteins [46456] (290 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.2: Cobalamin adenosyltransferase-like [89028] (3 families) crossover loop goes across a different side of the 4-helical bundle; no internal metal-binding site |
Family a.25.2.0: automated matches [191442] (1 protein) not a true family |
Protein automated matches [190652] (6 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:1773] [187731] (5 PDB entries) |
Domain d6wgva_: 6wgv A: [400873] automated match to d3gaha_ complexed with 3po, 5ad, b12, mg |
PDB Entry: 6wgv (more details), 2.15 Å
SCOPe Domain Sequences for d6wgva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6wgva_ a.25.2.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]} dgttglsdmsrvaktdarlvayadcdeanaaigaalalghpdtqitdvlrqiqndlfdag adlstpivenpkhpplriaqsyidrlegwcdaynaglpalksfvlpggsplsallhvart vvrraersawaavdahpegvsvlpakylnrlsdllfilsrvanpdgdvlwrpg
Timeline for d6wgva_: