Lineage for d6w10a_ (6w10 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2885833Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) (S)
    consists of one domain of this fold
  5. 2886484Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (17 proteins)
    contains Pfam PF00929
  6. 2886849Protein Three prime repair exonuclease 1, TREX1 [159631] (1 species)
  7. 2886850Species Mouse (Mus musculus) [TaxId:10090] [159632] (7 PDB entries)
    Uniprot Q91XB0 5-234! Uniprot Q91XB0 9-234
  8. 2886855Domain d6w10a_: 6w10 A: [400842]
    Other proteins in same PDB: d6w10b2
    automated match to d3mxjb_
    mutant

Details for d6w10a_

PDB Entry: 6w10 (more details), 1.8 Å

PDB Description: structure of mouse trex1 with e198k disease-associated mutation
PDB Compounds: (A:) Three-prime repair exonuclease 1

SCOPe Domain Sequences for d6w10a_:

Sequence, based on SEQRES records: (download)

>d6w10a_ c.55.3.5 (A:) Three prime repair exonuclease 1, TREX1 {Mouse (Mus musculus) [TaxId: 10090]}
tlphghmqtlifldleatglpssrpevtelcllavhrralentsisqghpppvprpprvv
dklslciapgkacspgaseitglskaelevqgrqrfddnlaillraflqrqpqpcclvah
ngdrydfpllqtelarlstpspldgtfcvdsiaalkaleqasspsgngsrksyslgsiyt
rlywqaptdshtakgdvltllsicqwkpqallqwvdeharpfstvkpmyg

Sequence, based on observed residues (ATOM records): (download)

>d6w10a_ c.55.3.5 (A:) Three prime repair exonuclease 1, TREX1 {Mouse (Mus musculus) [TaxId: 10090]}
tlphghmqtlifldleatglpssrpevtelcllavhrralentsisqghpppvprpprvv
dklslciapgkacspgaseitglskaelevqgrqrfddnlaillraflqrqpqpcclvah
ngdrydfpllqtelarlstpspldgtfcvdsiaalkaleqassksyslgsiytrlywqap
tdshtakgdvltllsicqwkpqallqwvdeharpfstvkpmyg

SCOPe Domain Coordinates for d6w10a_:

Click to download the PDB-style file with coordinates for d6w10a_.
(The format of our PDB-style files is described here.)

Timeline for d6w10a_: