Lineage for d1bmsb_ (1bms B:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 607033Fold d.85: RNA bacteriophage capsid protein [55404] (1 superfamily)
    6-standed beta-sheet followed with 2 helices; meander
  4. 607034Superfamily d.85.1: RNA bacteriophage capsid protein [55405] (1 family) (S)
  5. 607035Family d.85.1.1: RNA bacteriophage capsid protein [55406] (5 proteins)
  6. 607084Protein MS2 virus coat protein [55407] (1 species)
  7. 607085Species Bacteriophage MS2 [TaxId:12022] [55408] (26 PDB entries)
  8. 607136Domain d1bmsb_: 1bms B: [40083]

Details for d1bmsb_

PDB Entry: 1bms (more details), 2.7 Å

PDB Description: crystal structure of ms2 capsids with mutations in the subunit fg loop

SCOP Domain Sequences for d1bmsb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bmsb_ d.85.1.1 (B:) MS2 virus coat protein {Bacteriophage MS2}
asnftqfvlvdnggtgdvtvapsnfangvaewissnsrsqaykvtcsvrqssaqnrkyti
kvevpkvatqtvggvelnvaawrsylnmeltipifatnsdcelivkamqgllkdgnpips
aiaansgiy

SCOP Domain Coordinates for d1bmsb_:

Click to download the PDB-style file with coordinates for d1bmsb_.
(The format of our PDB-style files is described here.)

Timeline for d1bmsb_: