Lineage for d1bmsa_ (1bms A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2962441Fold d.85: RNA bacteriophage capsid protein [55404] (1 superfamily)
    6-standed beta-sheet followed with 2 helices; meander
  4. 2962442Superfamily d.85.1: RNA bacteriophage capsid protein [55405] (1 family) (S)
  5. 2962443Family d.85.1.1: RNA bacteriophage capsid protein [55406] (6 proteins)
  6. 2962492Protein MS2 virus coat protein [55407] (1 species)
  7. 2962493Species Bacteriophage MS2 [TaxId:12022] [55408] (36 PDB entries)
    Uniprot P03612
  8. 2962540Domain d1bmsa_: 1bms A: [40082]
    mutant

Details for d1bmsa_

PDB Entry: 1bms (more details), 2.7 Å

PDB Description: crystal structure of ms2 capsids with mutations in the subunit fg loop
PDB Compounds: (A:) bacteriophage ms2 capsid

SCOPe Domain Sequences for d1bmsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bmsa_ d.85.1.1 (A:) MS2 virus coat protein {Bacteriophage MS2 [TaxId: 12022]}
asnftqfvlvdnggtgdvtvapsnfangvaewissnsrsqaykvtcsvrqssaqnrkyti
kvevpkvatqtvggvelnvaawrsylnmeltipifatnsdcelivkamqgllkdgnpips
aiaansgiy

SCOPe Domain Coordinates for d1bmsa_:

Click to download the PDB-style file with coordinates for d1bmsa_.
(The format of our PDB-style files is described here.)

Timeline for d1bmsa_: