Class b: All beta proteins [48724] (180 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold |
Family b.82.2.2: Clavaminate synthase [51203] (2 proteins) |
Protein automated matches [400751] (1 species) not a true protein |
Species Streptomyces antibioticus [TaxId:1890] [400752] (2 PDB entries) |
Domain d6vwqa1: 6vwq A:1-324 [400810] Other proteins in same PDB: d6vwqa2 automated match to d1ds1a_ complexed with rqj, sin, vvo |
PDB Entry: 6vwq (more details), 1.5 Å
SCOPe Domain Sequences for d6vwqa1:
Sequence, based on SEQRES records: (download)
>d6vwqa1 b.82.2.2 (A:1-324) automated matches {Streptomyces antibioticus [TaxId: 1890]} mtvvdcseysadllalasrlpriprqdlygfldaaheaagdlpeglgtaldrfnadgshd gylmlrglpveddddlpatptstpapvdrplqnmeamlavigrrlglhtgyrelrsgtvy hdvypspgahhlssetsetllefhtemayhvlqpnyvmlacsradherkaatlvgsirka lplipeevrarlfdrpmpccvdvafrggvenpgaianvkplygdprdpflgydrellapr epddveavavlskaldevseavrltpgdllvvdnfrtthartpfsprwdgkdrwlhrvyi rtdrndqlsggeragdvvdfsprr
>d6vwqa1 b.82.2.2 (A:1-324) automated matches {Streptomyces antibioticus [TaxId: 1890]} mtvvdcseysadllalasrlpriprqdlygfldaaheaagdlpeglgtaldrfnadgshd gylmlrglpveddddlpatptstpapvdrplqnmeamlavigrrlglhtgyrelrsgtvy hdvypspgahhlssetsetllefhtemayhvlqpnyvmlacsradherkaatlvgsirka lplipeevrarlfdrpmpccvdvafrgnpgaianvkplygdprdpflgydrellaprepd dveavavlskaldevseavrltpgdllvvdnfrtthartpfsprwdgkdrwlhrvyirtd rndqlsggeragdvvdfsprr
Timeline for d6vwqa1: