Lineage for d1aq3c_ (1aq3 C:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2203937Fold d.85: RNA bacteriophage capsid protein [55404] (1 superfamily)
    6-standed beta-sheet followed with 2 helices; meander
  4. 2203938Superfamily d.85.1: RNA bacteriophage capsid protein [55405] (1 family) (S)
  5. 2203939Family d.85.1.1: RNA bacteriophage capsid protein [55406] (6 proteins)
  6. 2203988Protein MS2 virus coat protein [55407] (1 species)
  7. 2203989Species Bacteriophage MS2 [TaxId:12022] [55408] (36 PDB entries)
    Uniprot P03612
  8. 2204061Domain d1aq3c_: 1aq3 C: [40081]
    protein/RNA complex

Details for d1aq3c_

PDB Entry: 1aq3 (more details), 2.8 Å

PDB Description: bacteriophage ms2 capsid protein/rna complex
PDB Compounds: (C:) protein (bacteriophage ms2 coat protein)

SCOPe Domain Sequences for d1aq3c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aq3c_ d.85.1.1 (C:) MS2 virus coat protein {Bacteriophage MS2 [TaxId: 12022]}
asnftqfvlvdnggtgdvtvapsnfangvaewissnsrsqaykvtcsvrqssaqnrkysi
kvevpkvatqtvggvelpvaawrsylnmeltipifatnsdcelivkamqgllkdgnpips
aiaansgiy

SCOPe Domain Coordinates for d1aq3c_:

Click to download the PDB-style file with coordinates for d1aq3c_.
(The format of our PDB-style files is described here.)

Timeline for d1aq3c_: