Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.85: RNA bacteriophage capsid protein [55404] (1 superfamily) 6-standed beta-sheet followed with 2 helices; meander |
Superfamily d.85.1: RNA bacteriophage capsid protein [55405] (1 family) |
Family d.85.1.1: RNA bacteriophage capsid protein [55406] (5 proteins) |
Protein MS2 virus coat protein [55407] (1 species) |
Species Bacteriophage MS2 [TaxId:12022] [55408] (27 PDB entries) Uniprot P03612 |
Domain d1aq3c_: 1aq3 C: [40081] protein/RNA complex; mutant |
PDB Entry: 1aq3 (more details), 2.8 Å
SCOP Domain Sequences for d1aq3c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1aq3c_ d.85.1.1 (C:) MS2 virus coat protein {Bacteriophage MS2 [TaxId: 12022]} asnftqfvlvdnggtgdvtvapsnfangvaewissnsrsqaykvtcsvrqssaqnrkysi kvevpkvatqtvggvelpvaawrsylnmeltipifatnsdcelivkamqgllkdgnpips aiaansgiy
Timeline for d1aq3c_: