Lineage for d1aq3b_ (1aq3 B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1916511Fold d.85: RNA bacteriophage capsid protein [55404] (1 superfamily)
    6-standed beta-sheet followed with 2 helices; meander
  4. 1916512Superfamily d.85.1: RNA bacteriophage capsid protein [55405] (1 family) (S)
  5. 1916513Family d.85.1.1: RNA bacteriophage capsid protein [55406] (6 proteins)
  6. 1916562Protein MS2 virus coat protein [55407] (1 species)
  7. 1916563Species Bacteriophage MS2 [TaxId:12022] [55408] (28 PDB entries)
    Uniprot P03612
  8. 1916617Domain d1aq3b_: 1aq3 B: [40080]
    protein/RNA complex

Details for d1aq3b_

PDB Entry: 1aq3 (more details), 2.8 Å

PDB Description: bacteriophage ms2 capsid protein/rna complex
PDB Compounds: (B:) protein (bacteriophage ms2 coat protein)

SCOPe Domain Sequences for d1aq3b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aq3b_ d.85.1.1 (B:) MS2 virus coat protein {Bacteriophage MS2 [TaxId: 12022]}
asnftqfvlvdnggtgdvtvapsnfangvaewissnsrsqaykvtcsvrqssaqnrkysi
kvevpkvatqtvggvelpvaawrsylnmeltipifatnsdcelivkamqgllkdgnpips
aiaansgiy

SCOPe Domain Coordinates for d1aq3b_:

Click to download the PDB-style file with coordinates for d1aq3b_.
(The format of our PDB-style files is described here.)

Timeline for d1aq3b_: