Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (29 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [188198] (822 PDB entries) |
Domain d6vx4k_: 6vx4 K: [400784] Other proteins in same PDB: d6vx4f_, d6vx4g_ automated match to d4nylb1 |
PDB Entry: 6vx4 (more details), 3.12 Å
SCOPe Domain Sequences for d6vx4k_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6vx4k_ b.1.1.0 (K:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} diqmtqsssylsvsqgdrvtitckasdhidnwlawyqqkpgnaprllisgatslktglps rfsgsgsgkdfslsitnlqtedvasyycqqywrtpytfgggtklei
Timeline for d6vx4k_: