Lineage for d6vx4k_ (6vx4 K:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2761094Domain d6vx4k_: 6vx4 K: [400784]
    Other proteins in same PDB: d6vx4f_, d6vx4g_
    automated match to d4nylb1

Details for d6vx4k_

PDB Entry: 6vx4 (more details), 3.12 Å

PDB Description: density-fitted model structure of antibody variable domains of tytx11 in complex with typhoid toxin
PDB Compounds: (K:) Variable Domain of Kappa Chain of TyTx11 Antibody

SCOPe Domain Sequences for d6vx4k_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6vx4k_ b.1.1.0 (K:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
diqmtqsssylsvsqgdrvtitckasdhidnwlawyqqkpgnaprllisgatslktglps
rfsgsgsgkdfslsitnlqtedvasyycqqywrtpytfgggtklei

SCOPe Domain Coordinates for d6vx4k_:

Click to download the PDB-style file with coordinates for d6vx4k_.
(The format of our PDB-style files is described here.)

Timeline for d6vx4k_: