Lineage for d6vx4f_ (6vx4 F:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2594378Fold d.151: DNase I-like [56218] (1 superfamily)
    contains beta-sandwich; duplication of alpha+beta motif
  4. 2594379Superfamily d.151.1: DNase I-like [56219] (4 families) (S)
  5. 2594494Family d.151.1.0: automated matches [191468] (1 protein)
    not a true family
  6. 2594495Protein automated matches [190734] (14 species)
    not a true protein
  7. 2594541Species Salmonella enterica [TaxId:220341] [400769] (1 PDB entry)
  8. 2594542Domain d6vx4f_: 6vx4 F: [400770]
    Other proteins in same PDB: d6vx4g_, d6vx4k_
    automated match to d4k6lf_

Details for d6vx4f_

PDB Entry: 6vx4 (more details), 3.12 Å

PDB Description: density-fitted model structure of antibody variable domains of tytx11 in complex with typhoid toxin
PDB Compounds: (F:) Cytolethal distending toxin subunit B

SCOPe Domain Sequences for d6vx4f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6vx4f_ d.151.1.0 (F:) automated matches {Salmonella enterica [TaxId: 220341]}
nisdykvmtwnlqgssasteskwnvnvrqllsgtagvdilmvqeagavptsavptgrhiq
pfgvgipideytwnlgttsrqdiryiyhsaidvgarrvnlaivsrqradnvyvlrpttva
srpvigiglgndvfltahalasggpdaaaivrvtinffrqpqmrhlswflagdfnrspdr
lendlmtehlervvavlapteptqigggildygvivdrapysqrvealrnpqlasdhypv
aflarsc

SCOPe Domain Coordinates for d6vx4f_:

Click to download the PDB-style file with coordinates for d6vx4f_.
(The format of our PDB-style files is described here.)

Timeline for d6vx4f_: