Lineage for d1dzsb_ (1dzs B:)
- Root: SCOP 1.57
Class d: Alpha and beta proteins (a+b) [53931] (194 folds) 
Fold d.85: RNA bacteriophage capsid protein [55404] (1 superfamily) Superfamily d.85.1: RNA bacteriophage capsid protein [55405] (1 family) 
Family d.85.1.1: RNA bacteriophage capsid protein [55406] (5 proteins) Protein MS2 virus coat protein [55407] (1 species) Species Bacteriophage MS2 [TaxId:12022] [55408] (22 PDB entries) 
Domain d1dzsb_: 1dzs B: [40077]
Details for d1dzsb_
PDB Entry: 1dzs (more details), 2.85 Å
PDB Description: ms2-rna hairpin (4one-5) complex
SCOP Domain Sequences for d1dzsb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dzsb_ d.85.1.1 (B:) MS2 virus coat protein {Bacteriophage MS2}
asnftqfvlvdnggtgdvtvapsnfangvaewissnsrsqaykvtcsvrqssaqnrkyti
kvevpkvatqtvggvelpvaawrsylnmeltipifatnsdcelivkamqgllkdgnpips
aiaansgiy
SCOP Domain Coordinates for d1dzsb_:
Click to download the PDB-style file with coordinates for d1dzsb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1dzsb_:
- d1dzsb_ first appeared (with stable ids) in SCOP 1.55
- d1dzsb_ appears in SCOP 1.59
- d1dzsb_ last appears in SCOP 1.71
View in 3D
