SCOPe 2.07: Domain d6vp2a1: 6vp2 A:14-134

Lineage for d6vp2a1 (6vp2 A:14-134)

Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds)
Fold b.61: Streptavidin-like [50875] (8 superfamilies)
barrel, closed; n=8, S=10; meander
Superfamily b.61.1: Avidin/streptavidin [50876] (2 families)
Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)
Protein automated matches [190191] (2 species)
not a true protein
Species Streptomyces avidinii [TaxId:1895] [189343] (98 PDB entries)
Domain d6vp2a1: 6vp2 A:14-134 [400767]
Other proteins in same PDB: d6vp2a2, d6vp2b2, d6vp2c2, d6vp2d2
automated match to d2bc3b_
complexed with act, azi, km3

Details for d6vp2a1

PDB Entry: 6vp2 (more details), 1.8 Å

PDB Description: artificial metalloproteins with dinuclear iron centers

PDB Compounds: (A:) streptavidin

SCOPe Domain Sequences for d6vp2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6vp2a1 b.61.1.1 (A:14-134) automated matches {Streptomyces avidinii [TaxId: 1895]}
eagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtal
gwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawastyvghdtftkv
k

SCOPe Domain Coordinates for d6vp2a1:

Click to download the PDB-style file with coordinates for d6vp2a1.
(The format of our PDB-style files is described here.)

Timeline for d6vp2a1: