Lineage for d1dzsa_ (1dzs A:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 34001Fold d.85: RNA bacteriophage capsid protein [55404] (1 superfamily)
  4. 34002Superfamily d.85.1: RNA bacteriophage capsid protein [55405] (1 family) (S)
  5. 34003Family d.85.1.1: RNA bacteriophage capsid protein [55406] (5 proteins)
  6. 34052Protein MS2 virus coat protein [55407] (1 species)
  7. 34053Species Bacteriophage MS2 [TaxId:12022] [55408] (21 PDB entries)
  8. Domain d1dzsa_: 1dzs A: [40076]

Details for d1dzsa_

PDB Entry: 1dzs (more details), 2.85 Å

PDB Description: ms2-rna hairpin (4one-5) complex

SCOP Domain Sequences for d1dzsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dzsa_ d.85.1.1 (A:) MS2 virus coat protein {Bacteriophage MS2}
asnftqfvlvdnggtgdvtvapsnfangvaewissnsrsqaykvtcsvrqssaqnrkyti
kvevpkvatqtvggvelpvaawrsylnmeltipifatnsdcelivkamqgllkdgnpips
aiaansgiy

SCOP Domain Coordinates for d1dzsa_ are not available.

Timeline for d1dzsa_:

Domains from other chains:
(mouse over for more information)
d1dzsb_, d1dzsc_