SCOPe 2.08: Domain d6vnlb1: 6vnl B:840-1132

Lineage for d6vnlb1 (6vnl B:840-1132)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.0: automated matches [191359] (1 protein)
   not a true family

6. Protein automated matches [190417] (37 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187294] (1476 PDB entries)

8. Domain d6vnlb1: 6vnl B:840-1132 [400747]
   Other proteins in same PDB: d6vnla2, d6vnlb2
   automated match to d4hgeb_
   complexed with 5w2

Details for d6vnlb1

PDB Entry: 6vnl, 2.4 Å

PDB Description: jak2 jh1 in complex with sg3-179

PDB Compounds: (B:) Tyrosine-protein kinase JAK2

SCOPe Domain Sequences for d6vnlb1:

Sequence; same for both SEQRES and ATOM records:

>d6vnlb1 d.144.1.0 (B:840-1132) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dptqfeerhlkflqqlgkgnfgsvemcrydplqdntgevvavkklqhsteehlrdferei
eilkslqhdnivkykgvcysagrrnlklimeylpygslrdylqkhkeridhikllqytsq
ickgmeylgtkryihrdlatrnilvenenrvkigdfgltkvlpqdkeyykvkepgespif
wyapeslteskfsvasdvwsfgvvlyelftyieksksppaefmrmigndkqgqmivfhli
ellknngrlprpdgcpdeiymimtecwnnnvnqrpsfrdlalrvdqirdnmag

Timeline for d6vnlb1:

• d6vnlb1 first appeared in SCOPe 2.07