Lineage for d6vqpa_ (6vqp A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3001353Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 3001354Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 3002276Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 3002277Protein automated matches [190159] (21 species)
    not a true protein
  7. 3002666Species Micromonospora echinospora [TaxId:1877] [400715] (3 PDB entries)
  8. 3002667Domain d6vqpa_: 6vqp A: [400716]
    automated match to d2q17a_
    complexed with gol, mg

Details for d6vqpa_

PDB Entry: 6vqp (more details), 2 Å

PDB Description: structure of calu17 from the calicheamicin biosynthesis pathway of micromonospora echinospora
PDB Compounds: (A:) CalU17

SCOPe Domain Sequences for d6vqpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6vqpa_ d.169.1.0 (A:) automated matches {Micromonospora echinospora [TaxId: 1877]}
avpgdmvripggtflqgspertldwldregqafprdwftdetpqipvtlpdylidrhqvt
vaqfaafvsrtgyvtsaeraggsmvygeqyweiregacwhrpagygsgirgrddhpvvhi
sfadaeayarwagrrlpteseweraatgpsyrlwpwgdtwdsrnantaehtagalgdlda
wrtwwgaihavqgpmpqttpvgafsprgdsvdgcadmtgnvyewtstlahlyspatrcdp
tihlvmgrsrvirggswmnfryqvrcaerlygdptgwsnfalgfrcardvta

SCOPe Domain Coordinates for d6vqpa_:

Click to download the PDB-style file with coordinates for d6vqpa_.
(The format of our PDB-style files is described here.)

Timeline for d6vqpa_: