SCOPe 2.07: Domain d6vuga2: 6vug A:430-552

Lineage for d6vuga2 (6vug A:430-552)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (16 families)
   consists of one domain of this fold

5. Family c.55.3.0: automated matches [191357] (1 protein)
   not a true family

6. Protein automated matches [190396] (40 species)
   not a true protein

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [353118] (4 PDB entries)

8. Domain d6vuga2: 6vug A:430-552 [400700]
   Other proteins in same PDB: d6vuga1, d6vugb_, d6vugc1, d6vugc2, d6vugd_
   automated match to d1dloa1
   complexed with gol, so4

Details for d6vuga2

PDB Entry: 6vug, 3 Å

PDB Description: diabody bound to a reverse transcriptase aptamer complex

PDB Compounds: (A:) Reverse transcriptase/ribonuclease H

SCOPe Domain Sequences for d6vuga2:

Sequence; same for both SEQRES and ATOM records:

>d6vuga2 c.55.3.0 (A:430-552) automated matches {Human immunodeficiency virus type 1 [TaxId: 11676]}
ekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahkgiggneqvd
klv

Timeline for d6vuga2:

• d6vuga2 is new in SCOPe 2.07-stable
  
• d6vuga2 appears in the current release, SCOPe 2.08