SCOPe 2.08: Domain d6vbaa1: 6vba A:85-304

Lineage for d6vbaa1 (6vba A:85-304)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.18: Uracil-DNA glycosylase-like [52140] (1 superfamily)
   3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.18.1: Uracil-DNA glycosylase-like [52141] (5 families)

5. Family c.18.1.1: Uracil-DNA glycosylase [52142] (2 proteins)

6. Protein Uracil-DNA glycosylase [52143] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52144] (16 PDB entries)

8. Domain d6vbaa1: 6vba A:85-304 [400694]
   Other proteins in same PDB: d6vbaa2
   automated match to d1emha_
   complexed with qu4

Details for d6vbaa1

PDB Entry: 6vba, 1.8 Å

PDB Description: structure of human uracil dna glycosylase (udg) bound to aurintricarboxylic acid (ata)

PDB Compounds: (A:) uracil-DNA glycosylase

SCOPe Domain Sequences for d6vbaa1:

Sequence; same for both SEQRES and ATOM records:

>d6vbaa1 c.18.1.1 (A:85-304) Uracil-DNA glycosylase {Human (Homo sapiens) [TaxId: 9606]}
fgeswkkhlsgefgkpyfiklmgfvaeerkhytvyppphqvftwtqmcdikdvkvvilgq
dpyhgpnqahglcfsvqrpvppppsleniykelstdiedfvhpghgdlsgwakqgvllln
avltvrahqanshkergweqftdavvswlnqnsnglvfllwgsyaqkkgsaidrkrhhvl
qtahpsplsvyrgffgcrhfsktnellqksgkkpidwkel

Timeline for d6vbaa1:

• d6vbaa1 first appeared in SCOPe 2.07, called d6vbaa_