SCOPe 2.05: Domain d6msfb_: 6msf B:

Lineage for d6msfb_ (6msf B:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.85: RNA bacteriophage capsid protein [55404] (1 superfamily)
   6-standed beta-sheet followed with 2 helices; meander

4. Superfamily d.85.1: RNA bacteriophage capsid protein [55405] (1 family)

5. Family d.85.1.1: RNA bacteriophage capsid protein [55406] (6 proteins)

6. Protein MS2 virus coat protein [55407] (1 species)

7. Species Bacteriophage MS2 [TaxId:12022] [55408] (28 PDB entries)
   Uniprot P03612

8. Domain d6msfb_: 6msf B: [40068]
   protein/RNA complex

Details for d6msfb_

PDB Entry: 6msf, 2.8 Å

PDB Description: f6 aptamer ms2 coat protein complex

PDB Compounds: (B:) protein (ms2 protein capsid)

SCOPe Domain Sequences for d6msfb_:

Sequence; same for both SEQRES and ATOM records:

>d6msfb_ d.85.1.1 (B:) MS2 virus coat protein {Bacteriophage MS2 [TaxId: 12022]}
asnftqfvlvdnggtgdvtvapsnfangvaewissnsrsqaykvtcsvrqssaqnrkyti
kvevpkvatqtvggvelpvaawrsylnmeltipifatnsdcelivkamqgllkdgnpips
aiaansgiy

Timeline for d6msfb_:

• d6msfb_ first appeared (with stable ids) in SCOP 1.55
  
• d6msfb_ appears in SCOPe 2.04
  
• d6msfb_ appears in SCOPe 2.06
  
• d6msfb_ appears in the current release, SCOPe 2.08