Lineage for d6vkxa_ (6vkx A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780621Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2780622Protein automated matches [190437] (70 species)
    not a true protein
  7. 2781109Species Human rotavirus a [TaxId:10941] [187643] (15 PDB entries)
  8. 2781114Domain d6vkxa_: 6vkx A: [400674]
    automated match to d5jdba_
    complexed with peg, pg4

Details for d6vkxa_

PDB Entry: 6vkx (more details), 1.71 Å

PDB Description: crystal structure of the carbohydrate-binding domain vp8* of human p[8] rotavirus strain bm13851
PDB Compounds: (A:) Outer capsid protein VP4

SCOPe Domain Sequences for d6vkxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6vkxa_ b.29.1.0 (A:) automated matches {Human rotavirus a [TaxId: 10941]}
dgpyqpttftpptdywilinsntngvvyestnnsdfwtaviavephvnpvdrqynvfgen
kqfnvrndsdkwkflemfrgssqndfynrrtltsdtrlvgilkyggriwtfhgetpratt
dssntanlngisitihsefyiiprsqeskcneyinng

SCOPe Domain Coordinates for d6vkxa_:

Click to download the PDB-style file with coordinates for d6vkxa_.
(The format of our PDB-style files is described here.)

Timeline for d6vkxa_: