Lineage for d5msfc_ (5msf C:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1422709Fold d.85: RNA bacteriophage capsid protein [55404] (1 superfamily)
    6-standed beta-sheet followed with 2 helices; meander
  4. 1422710Superfamily d.85.1: RNA bacteriophage capsid protein [55405] (1 family) (S)
  5. 1422711Family d.85.1.1: RNA bacteriophage capsid protein [55406] (6 proteins)
  6. 1422760Protein MS2 virus coat protein [55407] (1 species)
  7. 1422761Species Bacteriophage MS2 [TaxId:12022] [55408] (27 PDB entries)
    Uniprot P03612
  8. 1422795Domain d5msfc_: 5msf C: [40060]
    protein/RNA complex

Details for d5msfc_

PDB Entry: 5msf (more details), 2.8 Å

PDB Description: ms2 protein capsid/rna complex
PDB Compounds: (C:) ms2 protein capsid

SCOPe Domain Sequences for d5msfc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5msfc_ d.85.1.1 (C:) MS2 virus coat protein {Bacteriophage MS2 [TaxId: 12022]}
asnftqfvlvdnggtgdvtvapsnfangvaewissnsrsqaykvtcsvrqssaqnrkyti
kvevpkvatqtvggvelpvaawrsylnmeltipifatnsdcelivkamqgllkdgnpips
aiaansgiy

SCOPe Domain Coordinates for d5msfc_:

Click to download the PDB-style file with coordinates for d5msfc_.
(The format of our PDB-style files is described here.)

Timeline for d5msfc_: