Lineage for d6tv0f2 (6tv0 F:87-156)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2564270Fold d.72: Cyanase C-terminal domain [55233] (1 superfamily)
    intertwined dimer of alpha-beta(2) motifs ; 2 layers, alpha/beta
  4. 2564271Superfamily d.72.1: Cyanase C-terminal domain [55234] (2 families) (S)
    automatically mapped to Pfam PF02560
  5. 2564357Family d.72.1.0: automated matches [271343] (1 protein)
    not a true family
  6. 2564358Protein automated matches [271344] (3 species)
    not a true protein
  7. 2564386Species Serratia sp. [TaxId:616] [400572] (1 PDB entry)
  8. 2564392Domain d6tv0f2: 6tv0 F:87-156 [400588]
    Other proteins in same PDB: d6tv0a1, d6tv0b1, d6tv0c1, d6tv0d1, d6tv0e1, d6tv0f1, d6tv0g1, d6tv0h1, d6tv0i1, d6tv0j1
    automated match to d6b6ma2
    complexed with gol, oxd

Details for d6tv0f2

PDB Entry: 6tv0 (more details), 1.96 Å

PDB Description: serratia spp. cyanase hydratase
PDB Compounds: (F:) cyanate hydratase

SCOPe Domain Sequences for d6tv0f2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6tv0f2 d.72.1.0 (F:87-156) automated matches {Serratia sp. [TaxId: 616]}
gvptdptiyrfyemvqiygstlkalvheqfgdgiisainfkldikkvpdpdggeravitl
dgkylptkpf

SCOPe Domain Coordinates for d6tv0f2:

Click to download the PDB-style file with coordinates for d6tv0f2.
(The format of our PDB-style files is described here.)

Timeline for d6tv0f2: