SCOPe 2.08: Domain d6tpca_: 6tpc A:

Lineage for d6tpca_ (6tpc A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.3: beta-glycanases [51487] (27 proteins)
   consist of a number of sequence families

6. Protein automated matches [190057] (28 species)
   not a true protein

7. Species Talaromyces verruculosus [TaxId:198730] [330334] (6 PDB entries)

8. Domain d6tpca_: 6tpc A: [400586]
   automated match to d5i6sa_
   complexed with nag, po4, so4

Details for d6tpca_

PDB Entry: 6tpc, 1.52 Å

PDB Description: crystal structure of endoglucanase n194a from penicillium verruculosum

PDB Compounds: (A:) endoglucanase

SCOPe Domain Sequences for d6tpca_:

Sequence; same for both SEQRES and ATOM records:

>d6tpca_ c.1.8.3 (A:) automated matches {Talaromyces verruculosus [TaxId: 198730]}
assfewfgsnesgaefgsgnipgvegtdytfpnttaiqilidagmnifrvpflmermipt
emtgsldtayfegysevinyitgkgahavvdphnfgryygtpisstsdfqtfwstlasqf
ksndlvifdtnneyhdmdesvvvalnqaaidgirdagattqyifvegnaysgawtwttyn
tamvaltdpsdlivyemhqyldsdgsgtsdqcvsstvgqervvdattwlqsngklgilge
faggansvceeavegmldylaensdvwlgaswwsagpwwqdyiysmeppngiayesylsi
letyf

Timeline for d6tpca_:

• d6tpca_ first appeared in SCOPe 2.07