Lineage for d5msfa_ (5msf A:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 331428Fold d.85: RNA bacteriophage capsid protein [55404] (1 superfamily)
    6-standed beta-sheet followed with 2 helices; meander
  4. 331429Superfamily d.85.1: RNA bacteriophage capsid protein [55405] (1 family) (S)
  5. 331430Family d.85.1.1: RNA bacteriophage capsid protein [55406] (5 proteins)
  6. 331479Protein MS2 virus coat protein [55407] (1 species)
  7. 331480Species Bacteriophage MS2 [TaxId:12022] [55408] (25 PDB entries)
  8. 331509Domain d5msfa_: 5msf A: [40058]

Details for d5msfa_

PDB Entry: 5msf (more details), 2.8 Å

PDB Description: ms2 protein capsid/rna complex

SCOP Domain Sequences for d5msfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5msfa_ d.85.1.1 (A:) MS2 virus coat protein {Bacteriophage MS2}
asnftqfvlvdnggtgdvtvapsnfangvaewissnsrsqaykvtcsvrqssaqnrkyti
kvevpkvatqtvggvelpvaawrsylnmeltipifatnsdcelivkamqgllkdgnpips
aiaansgiy

SCOP Domain Coordinates for d5msfa_:

Click to download the PDB-style file with coordinates for d5msfa_.
(The format of our PDB-style files is described here.)

Timeline for d5msfa_: