SCOP 1.59: Domain d1mstc_: 1mst C:

Lineage for d1mstc_ (1mst C:)

1. Root: SCOP 1.59

2. Class d: Alpha and beta proteins (a+b) [53931] (208 folds)

3. Fold d.85: RNA bacteriophage capsid protein [55404] (1 superfamily)

4. Superfamily d.85.1: RNA bacteriophage capsid protein [55405] (1 family)

5. Family d.85.1.1: RNA bacteriophage capsid protein [55406] (5 proteins)

6. Protein MS2 virus coat protein [55407] (1 species)

7. Species Bacteriophage MS2 [TaxId:12022] [55408] (25 PDB entries)

8. Domain d1mstc_: 1mst C: [40057]

Details for d1mstc_

PDB Entry: 1mst, 2.6 Å

PDB Description: crystal structure of ms2 capsids with mutations in the subunit fg loop

SCOP Domain Sequences for d1mstc_:

Sequence; same for both SEQRES and ATOM records:

>d1mstc_ d.85.1.1 (C:) MS2 virus coat protein {Bacteriophage MS2}
asnftqfvlvdnggtgdvtvapsnfangvaewissnsrsqaykvtcsvrqssaqnrkyti
kvevpkvatqtvggvdlpvaawrsylnmeltipifatnsdcelivkamqgllkdgnpips
aiaansgiy

Timeline for d1mstc_:

• d1mstc_ first appeared (with stable ids) in SCOP 1.55
  
• d1mstc_ appears in SCOP 1.57
  
• d1mstc_ appears in SCOP 1.61
  
• d1mstc_ appears in the current release, SCOPe 2.08