| Class d: Alpha and beta proteins (a+b) [53931] (234 folds) |
| Fold d.85: RNA bacteriophage capsid protein [55404] (1 superfamily) 6-standed beta-sheet followed with 2 helices; meander |
Superfamily d.85.1: RNA bacteriophage capsid protein [55405] (1 family) ![]() |
| Family d.85.1.1: RNA bacteriophage capsid protein [55406] (5 proteins) |
| Protein MS2 virus coat protein [55407] (1 species) |
| Species Bacteriophage MS2 [TaxId:12022] [55408] (25 PDB entries) |
| Domain d1msta_: 1mst A: [40055] |
PDB Entry: 1mst (more details), 2.6 Å
SCOP Domain Sequences for d1msta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1msta_ d.85.1.1 (A:) MS2 virus coat protein {Bacteriophage MS2}
asnftqfvlvdnggtgdvtvapsnfangvaewissnsrsqaykvtcsvrqssaqnrkyti
kvevpkvatqtvggvdlpvaawrsylnmeltipifatnsdcelivkamqgllkdgnpips
aiaansgiy
Timeline for d1msta_: