Lineage for d2ms2c_ (2ms2 C:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 507379Fold d.85: RNA bacteriophage capsid protein [55404] (1 superfamily)
    6-standed beta-sheet followed with 2 helices; meander
  4. 507380Superfamily d.85.1: RNA bacteriophage capsid protein [55405] (1 family) (S)
  5. 507381Family d.85.1.1: RNA bacteriophage capsid protein [55406] (5 proteins)
  6. 507430Protein MS2 virus coat protein [55407] (1 species)
  7. 507431Species Bacteriophage MS2 [TaxId:12022] [55408] (25 PDB entries)
  8. 507465Domain d2ms2c_: 2ms2 C: [40051]

Details for d2ms2c_

PDB Entry: 2ms2 (more details), 2.8 Å

PDB Description: the refined structure of bacteriophage ms2 at 2.8 angstroms resolution

SCOP Domain Sequences for d2ms2c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ms2c_ d.85.1.1 (C:) MS2 virus coat protein {Bacteriophage MS2}
asnftqfvlvdnggtgdvtvapsnfangvaewissnsrsqaykvtcsvrqssaqnrkyti
kvevpkvatqtvggvelpvaawrsylnmeltipifatnsdcelivkamqgllkdgnpips
aiaansgiy

SCOP Domain Coordinates for d2ms2c_:

Click to download the PDB-style file with coordinates for d2ms2c_.
(The format of our PDB-style files is described here.)

Timeline for d2ms2c_: