Lineage for d2ms2a_ (2ms2 A:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 867038Fold d.85: RNA bacteriophage capsid protein [55404] (1 superfamily)
    6-standed beta-sheet followed with 2 helices; meander
  4. 867039Superfamily d.85.1: RNA bacteriophage capsid protein [55405] (1 family) (S)
  5. 867040Family d.85.1.1: RNA bacteriophage capsid protein [55406] (5 proteins)
  6. 867089Protein MS2 virus coat protein [55407] (1 species)
  7. 867090Species Bacteriophage MS2 [TaxId:12022] [55408] (27 PDB entries)
    Uniprot P03612
  8. 867140Domain d2ms2a_: 2ms2 A: [40049]

Details for d2ms2a_

PDB Entry: 2ms2 (more details), 2.8 Å

PDB Description: the refined structure of bacteriophage ms2 at 2.8 angstroms resolution
PDB Compounds: (A:) bacteriophage ms2 coat protein

SCOP Domain Sequences for d2ms2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ms2a_ d.85.1.1 (A:) MS2 virus coat protein {Bacteriophage MS2 [TaxId: 12022]}
asnftqfvlvdnggtgdvtvapsnfangvaewissnsrsqaykvtcsvrqssaqnrkyti
kvevpkvatqtvggvelpvaawrsylnmeltipifatnsdcelivkamqgllkdgnpips
aiaansgiy

SCOP Domain Coordinates for d2ms2a_:

Click to download the PDB-style file with coordinates for d2ms2a_.
(The format of our PDB-style files is described here.)

Timeline for d2ms2a_: