Class b: All beta proteins [48724] (180 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.0: automated matches [191364] (1 protein) not a true family |
Protein automated matches [190438] (36 species) not a true protein |
Species Staphylococcus aureus [TaxId:367830] [400366] (1 PDB entry) |
Domain d6sf7a_: 6sf7 A: [400486] automated match to d4inka_ complexed with edo, peg, pg4, so4 |
PDB Entry: 6sf7 (more details), 1.7 Å
SCOPe Domain Sequences for d6sf7a_:
Sequence, based on SEQRES records: (download)
>d6sf7a_ b.47.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 367830]} entvkqitntnvapysgvtwmgagtgfvvgnhtiitnkavtyhmkvgdeikahpngfynn ggglykvtkivdypgkediavvqveekstqpkgrkfkdftskfniaseakenepisvigy pnpngnklqmyestgkvlsvngnivssdaiiqpgssgspilnskheaigviyagnkpsge strgfavyfspeikkfiadnldk
>d6sf7a_ b.47.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 367830]} entvkqitntnvapysgvtwmgagtgfvvgnhtiitnkavtyhmkvgdeikahpngfynn ggglykvtkivdypgkediavvqveekstqpkgrkfkdftskfniaseakenepisvigy pnpnnklqmyestgkvlsvngnivssdaiiqpgssgspilnskheaigviyagnkpsges trgfavyfspeikkfiadnldk
Timeline for d6sf7a_: