Lineage for d6sf7a_ (6sf7 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2794585Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2798202Family b.47.1.0: automated matches [191364] (1 protein)
    not a true family
  6. 2798203Protein automated matches [190438] (36 species)
    not a true protein
  7. 2798544Species Staphylococcus aureus [TaxId:367830] [400366] (1 PDB entry)
  8. 2798545Domain d6sf7a_: 6sf7 A: [400486]
    automated match to d4inka_
    complexed with edo, peg, pg4, so4

Details for d6sf7a_

PDB Entry: 6sf7 (more details), 1.7 Å

PDB Description: atomic resolution structure of splf protease from staphylococcus aureus
PDB Compounds: (A:) Serine protease SplF

SCOPe Domain Sequences for d6sf7a_:

Sequence, based on SEQRES records: (download)

>d6sf7a_ b.47.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 367830]}
entvkqitntnvapysgvtwmgagtgfvvgnhtiitnkavtyhmkvgdeikahpngfynn
ggglykvtkivdypgkediavvqveekstqpkgrkfkdftskfniaseakenepisvigy
pnpngnklqmyestgkvlsvngnivssdaiiqpgssgspilnskheaigviyagnkpsge
strgfavyfspeikkfiadnldk

Sequence, based on observed residues (ATOM records): (download)

>d6sf7a_ b.47.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 367830]}
entvkqitntnvapysgvtwmgagtgfvvgnhtiitnkavtyhmkvgdeikahpngfynn
ggglykvtkivdypgkediavvqveekstqpkgrkfkdftskfniaseakenepisvigy
pnpnnklqmyestgkvlsvngnivssdaiiqpgssgspilnskheaigviyagnkpsges
trgfavyfspeikkfiadnldk

SCOPe Domain Coordinates for d6sf7a_:

Click to download the PDB-style file with coordinates for d6sf7a_.
(The format of our PDB-style files is described here.)

Timeline for d6sf7a_: