Lineage for d1he0c_ (1he0 C:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 507379Fold d.85: RNA bacteriophage capsid protein [55404] (1 superfamily)
    6-standed beta-sheet followed with 2 helices; meander
  4. 507380Superfamily d.85.1: RNA bacteriophage capsid protein [55405] (1 family) (S)
  5. 507381Family d.85.1.1: RNA bacteriophage capsid protein [55406] (5 proteins)
  6. 507430Protein MS2 virus coat protein [55407] (1 species)
  7. 507431Species Bacteriophage MS2 [TaxId:12022] [55408] (25 PDB entries)
  8. 507504Domain d1he0c_: 1he0 C: [40048]

Details for d1he0c_

PDB Entry: 1he0 (more details), 2.68 Å

PDB Description: ms2-rna hairpin (2thiouracil-5) complex

SCOP Domain Sequences for d1he0c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1he0c_ d.85.1.1 (C:) MS2 virus coat protein {Bacteriophage MS2}
asnftqfvlvdnggtgdvtvapsnfangvaewissnsrsqaykvtcsvrqssaqnrkyti
kvevpkvatqtvggvelpvaawrsylnmeltipifatnsdcelivkamqgllkdgnpips
aiaansgiy

SCOP Domain Coordinates for d1he0c_:

Click to download the PDB-style file with coordinates for d1he0c_.
(The format of our PDB-style files is described here.)

Timeline for d1he0c_: