Lineage for d1he0b_ (1he0 B:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 331428Fold d.85: RNA bacteriophage capsid protein [55404] (1 superfamily)
    6-standed beta-sheet followed with 2 helices; meander
  4. 331429Superfamily d.85.1: RNA bacteriophage capsid protein [55405] (1 family) (S)
  5. 331430Family d.85.1.1: RNA bacteriophage capsid protein [55406] (5 proteins)
  6. 331479Protein MS2 virus coat protein [55407] (1 species)
  7. 331480Species Bacteriophage MS2 [TaxId:12022] [55408] (25 PDB entries)
  8. 331546Domain d1he0b_: 1he0 B: [40047]

Details for d1he0b_

PDB Entry: 1he0 (more details), 2.68 Å

PDB Description: ms2-rna hairpin (2thiouracil-5) complex

SCOP Domain Sequences for d1he0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1he0b_ d.85.1.1 (B:) MS2 virus coat protein {Bacteriophage MS2}
asnftqfvlvdnggtgdvtvapsnfangvaewissnsrsqaykvtcsvrqssaqnrkyti
kvevpkvatqtvggvelpvaawrsylnmeltipifatnsdcelivkamqgllkdgnpips
aiaansgiy

SCOP Domain Coordinates for d1he0b_:

Click to download the PDB-style file with coordinates for d1he0b_.
(The format of our PDB-style files is described here.)

Timeline for d1he0b_: