Lineage for d1hdwa_ (1hdw A:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 81852Fold d.85: RNA bacteriophage capsid protein [55404] (1 superfamily)
  4. 81853Superfamily d.85.1: RNA bacteriophage capsid protein [55405] (1 family) (S)
  5. 81854Family d.85.1.1: RNA bacteriophage capsid protein [55406] (5 proteins)
  6. 81903Protein MS2 virus coat protein [55407] (1 species)
  7. 81904Species Bacteriophage MS2 [TaxId:12022] [55408] (22 PDB entries)
  8. 81912Domain d1hdwa_: 1hdw A: [40040]

Details for d1hdwa_

PDB Entry: 1hdw (more details), 2.6 Å

PDB Description: ms2-rna hairpin (2thio-u-5-6) complex

SCOP Domain Sequences for d1hdwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hdwa_ d.85.1.1 (A:) MS2 virus coat protein {Bacteriophage MS2}
asnftqfvlvdnggtgdvtvapsnfangvaewissnsrsqaykvtcsvrqssaqnrkyti
kvevpkvatqtvggvelpvaawrsylnmeltipifatnsdcelivkamqgllkdgnpips
aiaansgiy

SCOP Domain Coordinates for d1hdwa_:

Click to download the PDB-style file with coordinates for d1hdwa_.
(The format of our PDB-style files is described here.)

Timeline for d1hdwa_: