| Class d: Alpha and beta proteins (a+b) [53931] (234 folds) |
| Fold d.85: RNA bacteriophage capsid protein [55404] (1 superfamily) 6-standed beta-sheet followed with 2 helices; meander |
Superfamily d.85.1: RNA bacteriophage capsid protein [55405] (1 family) ![]() |
| Family d.85.1.1: RNA bacteriophage capsid protein [55406] (5 proteins) |
| Protein MS2 virus coat protein [55407] (1 species) |
| Species Bacteriophage MS2 [TaxId:12022] [55408] (25 PDB entries) |
| Domain d1e6tb_: 1e6t B: [40034] |
PDB Entry: 1e6t (more details), 2.2 Å
SCOP Domain Sequences for d1e6tb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e6tb_ d.85.1.1 (B:) MS2 virus coat protein {Bacteriophage MS2}
asnftqfvlvdnggtgdvtvapsnfangvaewissnsrsqaykvtcsvrqssaqnrkyti
kvevpkvatqtvggvelpvaawrsylnmeltipifatnsdcelivkamqgllkdgnpips
aiaansgiy
Timeline for d1e6tb_: