|  | Class d: Alpha and beta proteins (a+b) [53931] (194 folds) | 
|  | Fold d.85: RNA bacteriophage capsid protein [55404] (1 superfamily) | 
|  | Superfamily d.85.1: RNA bacteriophage capsid protein [55405] (1 family)  | 
|  | Family d.85.1.1: RNA bacteriophage capsid protein [55406] (5 proteins) | 
|  | Protein MS2 virus coat protein [55407] (1 species) | 
|  | Species Bacteriophage MS2 [TaxId:12022] [55408] (22 PDB entries) | 
|  | Domain d1e6tb_: 1e6t B: [40034] | 
PDB Entry: 1e6t (more details), 2.2 Å
SCOP Domain Sequences for d1e6tb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e6tb_ d.85.1.1 (B:) MS2 virus coat protein {Bacteriophage MS2}
asnftqfvlvdnggtgdvtvapsnfangvaewissnsrsqaykvtcsvrqssaqnrkyti
kvevpkvatqtvggvelpvaawrsylnmeltipifatnsdcelivkamqgllkdgnpips
aiaansgiy
Timeline for d1e6tb_: