SCOP 1.71: Domain d2sici_: 2sic I:

Lineage for d2sici_ (2sic I:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.84: Subtilisin inhibitor [55398] (1 superfamily)
   alpha+beta sandwich

4. Superfamily d.84.1: Subtilisin inhibitor [55399] (1 family)

5. Family d.84.1.1: Subtilisin inhibitor [55400] (1 protein)

6. Protein Subtilisin inhibitor [55401] (2 species)

7. Species Streptomyces albogriseolus, s-3253 [TaxId:1887] [55403] (2 PDB entries)

8. Domain d2sici_: 2sic I: [40031]
   Other proteins in same PDB: d2sice_
   complexed with ca

Details for d2sici_

PDB Entry: 2sic, 1.8 Å

PDB Description: refined crystal structure of the complex of subtilisin bpn' and streptomyces subtilisin inhibitor at 1.8 angstroms resolution

SCOP Domain Sequences for d2sici_:

Sequence; same for both SEQRES and ATOM records:

>d2sici_ d.84.1.1 (I:) Subtilisin inhibitor {Streptomyces albogriseolus, s-3253}
yapsalvltvgkgvsattaaperavtltcapgpsgthpaagsacadlaavggdlnaltrg
edvmcpmvydpvlltvdgvwqgkrvsyervfsnecemnahgssvfaf

Timeline for d2sici_:

• d2sici_ first appeared (with stable ids) in SCOP 1.55
  
• d2sici_ appears in SCOP 1.69
  
• d2sici_ appears in SCOP 1.73
  
• d2sici_ appears in the current release, SCOPe 2.08