Lineage for d2tldi_ (2tld I:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 33990Fold d.84: Subtilisin inhibitor [55398] (1 superfamily)
  4. 33991Superfamily d.84.1: Subtilisin inhibitor [55399] (1 family) (S)
  5. 33992Family d.84.1.1: Subtilisin inhibitor [55400] (1 protein)
  6. 33993Protein Subtilisin inhibitor [55401] (2 species)
  7. 33997Species Streptomyces lividans [TaxId:1916] [55402] (3 PDB entries)
  8. 34000Domain d2tldi_: 2tld I: [40030]
    Other proteins in same PDB: d2tlde_

Details for d2tldi_

PDB Entry: 2tld (more details), 2.6 Å

PDB Description: crystal structure of an engineered subtilisin inhibitor complexed with bovine trypsin

SCOP Domain Sequences for d2tldi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2tldi_ d.84.1.1 (I:) Subtilisin inhibitor {Streptomyces lividans}
salyapsalvltvgkgvsattaaperavtltcapgpsgthpaagsacadlaavggdlnal
trgedvgcpkvydpvlltvdgvwqgkrvsyervfsnecemnahgssvfaf

SCOP Domain Coordinates for d2tldi_:

Click to download the PDB-style file with coordinates for d2tldi_.
(The format of our PDB-style files is described here.)

Timeline for d2tldi_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2tlde_